PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00555.1.p
Common NameEUGRSUZ_K00555, LOC104424612
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 436aa    MW: 48138.6 Da    PI: 6.8502
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00555.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+l+++++q+G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.K00555.1.p 14 KGLWSPEEDEKLLRYITQYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                      678*******************************************97 PP

2Myb_DNA-binding475.8e-1567110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg +++eE++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Eucgr.K00555.1.p  67 RGTFSQEEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                       899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129419.02961IPR017930Myb domain
SuperFamilySSF466891.27E-2912108IPR009057Homeodomain-like
SMARTSM007171.6E-131363IPR001005SANT/Myb domain
PfamPF002498.9E-161461IPR001005SANT/Myb domain
CDDcd001672.43E-121761No hitNo description
PROSITE profilePS5129425.89362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-2665116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PfamPF002498.2E-1467111IPR001005SANT/Myb domain
CDDcd001676.99E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRYIT QYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPATHKPLS EVEHGGDDKS TTPKSHERAA FSGSSNGLSQ TQQAPNSENT LLEHCSSSNA  180
NNSSKISNLM NSSLDKDCFP NGLLSSTSSC QPSDDLVGHF PLQPLGNYAS ISRLSEAISN  240
HSPWFGQSGK SFSINTEFGC STMPAILPHS NISFHHDPVG FRPAMTVPND NYCFKPFTVD  300
ESRYWEVNAP TSSGAANAEL LGSGSYFENS MLSWGLENCN TMGKEADMNN PPGGHIGDIK  360
LPDYFHDPLL IGAASQHQAP QSLYNEIKPD THFDTNYSSS AMWLQNQQDQ GLLPSSDTSS  420
CPKNIQRLTA LFGHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00555.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035368.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A058ZZ510.0A0A058ZZ51_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s10680.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.16e-93myb domain protein 61